PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G21740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 277aa    MW: 30199.2 Da    PI: 8.998
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G21740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.41e-32123179158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  OBART07G21740.1 123 EEPIFVNAKQYHAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 179
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-37121182IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.238122182IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-27124179IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-24125147IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860127147IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.6E-24156179IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MKQLGHKMYD QDSPSSDSGQ SHQEESAMND SSPNERHTST QSDNDDGHQM PDQDKTKSVS  60
SLGNPGALPP KLDYSQSFAC IPYTADAYYG GVLTGYSSHA IVHPQQNGTA NSRVPLPVEP  120
AAEEPIFVNA KQYHAILRRR QIRAKLEAQN KLVKGRKPYL HESRHRHAMK RARGSGGRFL  180
NTKQLEEQKQ QQEEEAASGG ASSGNRTCLQ NGTGSAPSAS SPSEIASVST SREFLGNHEQ  240
SHFPSAGFLP TMSFRAQNGG DGKLVANAIH QRVSMMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-23123184263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163172RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880330.0AB288033.1 Oryza sativa Japonica Group OsHAP2G mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1016840.0AK101684.1 Oryza sativa Japonica Group cDNA clone:J033058N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646559.10.0PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646560.10.0PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646561.10.0PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646562.10.0PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ9LNP61e-42NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A0D3GTD40.0A0A0D3GTD4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0AMI40.0A0A0E0AMI4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HQH20.0A0A0E0HQH2_ORYNI; Uncharacterized protein
STRINGORGLA07G0166900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.19e-34nuclear factor Y, subunit A5